COQ9 polyclonal antibody
  • COQ9 polyclonal antibody

COQ9 polyclonal antibody

Ref: AB-PAB23716
COQ9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COQ9.
Información adicional
Size 100 uL
Gene Name COQ9
Gene Alias C16orf49|DKFZp434K046
Gene Description coenzyme Q9 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COQ9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57017
Iso type IgG

Enviar un mensaje


COQ9 polyclonal antibody

COQ9 polyclonal antibody