N4BP1 polyclonal antibody
  • N4BP1 polyclonal antibody

N4BP1 polyclonal antibody

Ref: AB-PAB23705
N4BP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant N4BP1.
Información adicional
Size 100 uL
Gene Name N4BP1
Gene Alias FLJ31821|KIAA0615|MGC176730
Gene Description NEDD4 binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NELTTDSTPKKTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human N4BP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9683
Iso type IgG

Enviar un mensaje


N4BP1 polyclonal antibody

N4BP1 polyclonal antibody