C1orf68 polyclonal antibody
  • C1orf68 polyclonal antibody

C1orf68 polyclonal antibody

Ref: AB-PAB23704
C1orf68 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf68.
Información adicional
Size 100 uL
Gene Name C1orf68
Gene Alias LEP7
Gene Description chromosome 1 open reading frame 68
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf68.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100129271
Iso type IgG

Enviar un mensaje


C1orf68 polyclonal antibody

C1orf68 polyclonal antibody