TRAF3IP3 polyclonal antibody
  • TRAF3IP3 polyclonal antibody

TRAF3IP3 polyclonal antibody

Ref: AB-PAB23695
TRAF3IP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRAF3IP3.
Información adicional
Size 100 uL
Gene Name TRAF3IP3
Gene Alias DJ434O14.3|FLJ44151|MGC117354|MGC163289|T3JAM
Gene Description TRAF3 interacting protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRAF3IP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80342
Iso type IgG

Enviar un mensaje


TRAF3IP3 polyclonal antibody

TRAF3IP3 polyclonal antibody