ANKRD32 polyclonal antibody
  • ANKRD32 polyclonal antibody

ANKRD32 polyclonal antibody

Ref: AB-PAB23694
ANKRD32 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD32.
Información adicional
Size 100 uL
Gene Name ANKRD32
Gene Alias BRCTD1|BRCTx|DKFZp564C0469|DKFZp761C121
Gene Description ankyrin repeat domain 32
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EYAKESKAMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESLIEGHFFKEAIEELSTLQAHYIPPVC
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD32.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84250
Iso type IgG

Enviar un mensaje


ANKRD32 polyclonal antibody

ANKRD32 polyclonal antibody