DNAJC21 polyclonal antibody
  • DNAJC21 polyclonal antibody

DNAJC21 polyclonal antibody

Ref: AB-PAB23692
DNAJC21 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC21.
Información adicional
Size 100 uL
Gene Name DNAJC21
Gene Alias DNAJA5|GS3|JJJ1
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 21
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HPFYAYWQSFCTQKNFAWKEEYDTRQASNRWEKRAMEKENKKIRDKARKEKNELVRQLVAFIRKRDKRVQAHRKLVEEQNA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC21.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 134218
Iso type IgG

Enviar un mensaje


DNAJC21 polyclonal antibody

DNAJC21 polyclonal antibody