RCCD1 polyclonal antibody
  • RCCD1 polyclonal antibody

RCCD1 polyclonal antibody

Ref: AB-PAB23689
RCCD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RCCD1.
Información adicional
Size 100 uL
Gene Name RCCD1
Gene Alias MGC14386
Gene Description RCC1 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PFIAVQPFPALLDLPMGSDAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFVDKQLQVKAVTCGPWNTYVYAVEKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RCCD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91433
Iso type IgG

Enviar un mensaje


RCCD1 polyclonal antibody

RCCD1 polyclonal antibody