LEO1 polyclonal antibody
  • LEO1 polyclonal antibody

LEO1 polyclonal antibody

Ref: AB-PAB23688
LEO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LEO1.
Información adicional
Size 100 uL
Gene Name LEO1
Gene Alias RDL
Gene Description Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SGQPSNKELFGDDSEDEGASHHSGSDNHSERSDNRSEASERSDHEDNDPSDVDQHSGSEAPNDDEDEGHRSDGGSHHSEAEGSEKAHSDDEKWGREDKSDQSDDEKIQNSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LEO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 123169
Iso type IgG

Enviar un mensaje


LEO1 polyclonal antibody

LEO1 polyclonal antibody