RAB12 polyclonal antibody
  • RAB12 polyclonal antibody

RAB12 polyclonal antibody

Ref: AB-PAB23687
RAB12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAB12.
Información adicional
Size 100 uL
Gene Name RAB12
Gene Alias FLJ45927|MGC104724
Gene Description RAB12, member RAS oncogene family
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAB12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201475
Iso type IgG

Enviar un mensaje


RAB12 polyclonal antibody

RAB12 polyclonal antibody