SLC24A6 polyclonal antibody
  • SLC24A6 polyclonal antibody

SLC24A6 polyclonal antibody

Ref: AB-PAB23680
SLC24A6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC24A6.
Información adicional
Size 100 uL
Gene Name SLC24A6
Gene Alias FLJ22233|NCKX6|NCLX
Gene Description solute carrier family 24 (sodium/potassium/calcium exchanger), member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQETTAQILVRALNPLDYMKWRRKSAYWKAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC24A6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80024
Iso type IgG

Enviar un mensaje


SLC24A6 polyclonal antibody

SLC24A6 polyclonal antibody