FOPNL polyclonal antibody
  • FOPNL polyclonal antibody

FOPNL polyclonal antibody

Ref: AB-PAB23672
FOPNL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FOPNL.
Información adicional
Size 100 uL
Gene Name FOPNL
Gene Alias C16orf63|FOR20|PHSECRG2
Gene Description FGFR1OP N-terminal like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq IHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FOPNL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 123811
Iso type IgG

Enviar un mensaje


FOPNL polyclonal antibody

FOPNL polyclonal antibody