NRIP3 polyclonal antibody
  • NRIP3 polyclonal antibody

NRIP3 polyclonal antibody

Ref: AB-PAB23669
NRIP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NRIP3.
Información adicional
Size 100 uL
Gene Name NRIP3
Gene Alias C11orf14|NY-SAR-105
Gene Description nuclear receptor interacting protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NRIP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56675
Iso type IgG

Enviar un mensaje


NRIP3 polyclonal antibody

NRIP3 polyclonal antibody