MNS1 polyclonal antibody
  • MNS1 polyclonal antibody

MNS1 polyclonal antibody

Ref: AB-PAB23653
MNS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MNS1.
Información adicional
Size 100 uL
Gene Name MNS1
Gene Alias FLJ11222|FLJ26051
Gene Description meiosis-specific nuclear structural 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QQVRENSIELRELEKKLKAAYMNKERAAQIAEKDAIKYEQMKRDAEIAKTMMEEHKRIIKEENAAEDKRNKAKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MNS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55329
Iso type IgG

Enviar un mensaje


MNS1 polyclonal antibody

MNS1 polyclonal antibody