CKAP5 polyclonal antibody
  • CKAP5 polyclonal antibody

CKAP5 polyclonal antibody

Ref: AB-PAB23651
CKAP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CKAP5.
Información adicional
Size 100 uL
Gene Name CKAP5
Gene Alias CHTOG|FLJ35359|KIAA0097|MSPS|TOG|TOGp|ch-TOG
Gene Description cytoskeleton associated protein 5
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq MSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRCEMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFI
Form Liquid
Recomended Dilution Immunofluorescence (0.25-2 ug/mL)
Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CKAP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9793
Iso type IgG

Enviar un mensaje


CKAP5 polyclonal antibody

CKAP5 polyclonal antibody