PIGN polyclonal antibody
  • PIGN polyclonal antibody

PIGN polyclonal antibody

Ref: AB-PAB23650
PIGN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PIGN.
Información adicional
Size 100 uL
Gene Name PIGN
Gene Alias MCD4|MDC4|MGC26427|PIG-N
Gene Description phosphatidylinositol glycan anchor biosynthesis, class N
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KVDDGVKEIVSMFNHFYGNDGKTTFIFTSDHGMTDWGSHGAGHPSETLTPLVTWGAGIKYPQRVSAQQFDDAFLKEWRLENWK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PIGN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23556
Iso type IgG

Enviar un mensaje


PIGN polyclonal antibody

PIGN polyclonal antibody