GADL1 polyclonal antibody
  • GADL1 polyclonal antibody

GADL1 polyclonal antibody

Ref: AB-PAB23639
GADL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GADL1.
Información adicional
Size 100 uL
Gene Name GADL1
Gene Alias MGC138191
Gene Description glutamate decarboxylase-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPFLVC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GADL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339896
Iso type IgG

Enviar un mensaje


GADL1 polyclonal antibody

GADL1 polyclonal antibody