AOX1 polyclonal antibody
  • AOX1 polyclonal antibody

AOX1 polyclonal antibody

Ref: AB-PAB23634
AOX1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AOX1.
Información adicional
Size 100 uL
Gene Name AOX1
Gene Alias AO|AOH1
Gene Description aldehyde oxidase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRKWE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AOX1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 316
Iso type IgG

Enviar un mensaje


AOX1 polyclonal antibody

AOX1 polyclonal antibody