NLRP10 polyclonal antibody
  • NLRP10 polyclonal antibody

NLRP10 polyclonal antibody

Ref: AB-PAB23622
NLRP10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NLRP10.
Información adicional
Size 100 uL
Gene Name NLRP10
Gene Alias CLR11.1|NALP10|NOD8|PAN5|PYNOD
Gene Description NLR family, pyrin domain containing 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RARYFSSYFTDEKQADRAFDIVQKNDILYKACQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NLRP10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 338322
Iso type IgG

Enviar un mensaje


NLRP10 polyclonal antibody

NLRP10 polyclonal antibody