C11orf54 polyclonal antibody
  • C11orf54 polyclonal antibody

C11orf54 polyclonal antibody

Ref: AB-PAB23620
C11orf54 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf54.
Información adicional
Size 100 uL
Gene Name C11orf54
Gene Alias PTD012
Gene Description chromosome 11 open reading frame 54
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf54.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 28970
Iso type IgG

Enviar un mensaje


C11orf54 polyclonal antibody

C11orf54 polyclonal antibody