CKAP2L polyclonal antibody
  • CKAP2L polyclonal antibody

CKAP2L polyclonal antibody

Ref: AB-PAB23618
CKAP2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CKAP2L.
Información adicional
Size 100 uL
Gene Name CKAP2L
Gene Alias FLJ40629|MGC39683
Gene Description cytoskeleton associated protein 2-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNNIHVENESLDNFLKETNKENLLDILTEPERKPDPKLYTRSKPKTDSYNQTKNSLVPKQALGKSSVNSAVLKDRVNKQFVGETQSRTFPVKSQQLSRGADLARPGVKPSRTVPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CKAP2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 150468
Iso type IgG

Enviar un mensaje


CKAP2L polyclonal antibody

CKAP2L polyclonal antibody