SPERT polyclonal antibody
  • SPERT polyclonal antibody

SPERT polyclonal antibody

Ref: AB-PAB23615
SPERT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPERT.
Información adicional
Size 100 uL
Gene Name SPERT
Gene Alias CBY2|FLJ35810|NURIT
Gene Description spermatid associated
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASQHSYPLNRFSSVPLDPMERPMSQADLELDYNPPRVQLSDEMFVFQDGRWVNENCRLQSPYFSPSASFHHKLHHK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPERT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 220082
Iso type IgG

Enviar un mensaje


SPERT polyclonal antibody

SPERT polyclonal antibody