FAM186B polyclonal antibody
  • FAM186B polyclonal antibody

FAM186B polyclonal antibody

Ref: AB-PAB23613
FAM186B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM186B.
Información adicional
Size 100 uL
Gene Name FAM186B
Gene Alias C12orf25|DKFZp434J0113|DKFZp434N2350
Gene Description family with sequence similarity 186, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VTMFPKLQLEWNVHLNIPEVTSPKPKKCKLPAASPRHIRPSGPTYKQPFLSRHRACVPLQMARQQGKQMEAVWKTEVASSSYAI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM186B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84070
Iso type IgG

Enviar un mensaje


FAM186B polyclonal antibody

FAM186B polyclonal antibody