KCNG1 polyclonal antibody
  • KCNG1 polyclonal antibody

KCNG1 polyclonal antibody

Ref: AB-PAB23612
KCNG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNG1.
Información adicional
Size 100 uL
Gene Name KCNG1
Gene Alias K13|KCNG|KV6.1|MGC12878|kH2
Gene Description potassium voltage-gated channel, subfamily G, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ELKQEQERVMFRRAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3755
Iso type IgG

Enviar un mensaje


KCNG1 polyclonal antibody

KCNG1 polyclonal antibody