MED19 polyclonal antibody
  • MED19 polyclonal antibody

MED19 polyclonal antibody

Ref: AB-PAB23597
MED19 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MED19.
Información adicional
Size 100 uL
Gene Name MED19
Gene Alias DT2P1G7|LCMR1
Gene Description mediator complex subunit 19
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq GSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MED19.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219541
Iso type IgG

Enviar un mensaje


MED19 polyclonal antibody

MED19 polyclonal antibody