NDUFA12 polyclonal antibody
  • NDUFA12 polyclonal antibody

NDUFA12 polyclonal antibody

Ref: AB-PAB23596
NDUFA12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NDUFA12.
Información adicional
Size 100 uL
Gene Name NDUFA12
Gene Alias B17.2|DAP13
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NDUFA12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55967
Iso type IgG

Enviar un mensaje


NDUFA12 polyclonal antibody

NDUFA12 polyclonal antibody