C11orf57 polyclonal antibody
  • C11orf57 polyclonal antibody

C11orf57 polyclonal antibody

Ref: AB-PAB23593
C11orf57 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf57.
Información adicional
Size 100 uL
Gene Name C11orf57
Gene Alias FLJ10726
Gene Description chromosome 11 open reading frame 57
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SGTLEDDFLKAKSWNKKFYDYEANMPDRWGHSGYKELYPEEFETDSSDQQDITNGKKTSPQVKSSTHESRKHKKSKKSH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf57.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55216
Iso type IgG

Enviar un mensaje


C11orf57 polyclonal antibody

C11orf57 polyclonal antibody