SPDYC polyclonal antibody
  • SPDYC polyclonal antibody

SPDYC polyclonal antibody

Ref: AB-PAB23592
SPDYC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPDYC.
Información adicional
Size 100 uL
Gene Name SPDYC
Gene Alias Ringo2
Gene Description speedy homolog C (Xenopus laevis)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SPLVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPDYC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 387778
Iso type IgG

Enviar un mensaje


SPDYC polyclonal antibody

SPDYC polyclonal antibody