SVIP polyclonal antibody
  • SVIP polyclonal antibody

SVIP polyclonal antibody

Ref: AB-PAB23582
SVIP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SVIP.
Información adicional
Size 100 uL
Gene Name SVIP
Gene Alias DKFZp313A2432
Gene Description small VCP/p97-interacting protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SVIP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 258010
Iso type IgG

Enviar un mensaje


SVIP polyclonal antibody

SVIP polyclonal antibody