TPCN1 polyclonal antibody
  • TPCN1 polyclonal antibody

TPCN1 polyclonal antibody

Ref: AB-PAB23577
TPCN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TPCN1.
Información adicional
Size 100 uL
Gene Name TPCN1
Gene Alias FLJ20612|KIAA1169|TPC1
Gene Description two pore segment channel 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FKSLLLHKRTAIQHAYRLLISQRRPAGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWFDELPRT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TPCN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 53373
Iso type IgG

Enviar un mensaje


TPCN1 polyclonal antibody

TPCN1 polyclonal antibody