C12orf29 polyclonal antibody
  • C12orf29 polyclonal antibody

C12orf29 polyclonal antibody

Ref: AB-PAB23568
C12orf29 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf29.
Información adicional
Size 100 uL
Gene Name C12orf29
Gene Alias DKFZp313K0436|DKFZp434N2030|DKFZp686L04169|FLJ38158|MGC102978
Gene Description chromosome 12 open reading frame 29
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf29.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91298
Iso type IgG

Enviar un mensaje


C12orf29 polyclonal antibody

C12orf29 polyclonal antibody