KIAA1524 polyclonal antibody
  • KIAA1524 polyclonal antibody

KIAA1524 polyclonal antibody

Ref: AB-PAB23561
KIAA1524 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1524.
Información adicional
Size 100 uL
Gene Name KIAA1524
Gene Alias FLJ12850|MGC163436|p90
Gene Description KIAA1524
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KMPWQSSNHSFPTSIKCLTPHLKDGVPGLNIEELIEKLQSGMVVKDQICDVRISDIMDVYEMKLSTLASKESRLQDLLETKALALAQADRLIAQHRCQRTQAET
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1524.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57650
Iso type IgG

Enviar un mensaje


KIAA1524 polyclonal antibody

KIAA1524 polyclonal antibody