CNTN5 polyclonal antibody
  • CNTN5 polyclonal antibody

CNTN5 polyclonal antibody

Ref: AB-PAB23551
CNTN5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNTN5.
Información adicional
Size 100 uL
Gene Name CNTN5
Gene Alias HNB-2s|MGC163491|NB-2
Gene Description contactin 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDII
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNTN5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 53942
Iso type IgG

Enviar un mensaje


CNTN5 polyclonal antibody

CNTN5 polyclonal antibody