KIF18A polyclonal antibody
  • KIF18A polyclonal antibody

KIF18A polyclonal antibody

Ref: AB-PAB23550
KIF18A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIF18A.
Información adicional
Size 100 uL
Gene Name KIF18A
Gene Alias DKFZp434G2226|MS-KIF18A
Gene Description kinesin family member 18A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq AFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTFTICEDIKSSKCKLPEQESLPNDNKDILQRLDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIF18A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81930
Iso type IgG

Enviar un mensaje


KIF18A polyclonal antibody

KIF18A polyclonal antibody