NLRP14 polyclonal antibody
  • NLRP14 polyclonal antibody

NLRP14 polyclonal antibody

Ref: AB-PAB23547
NLRP14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NLRP14.
Información adicional
Size 100 uL
Gene Name NLRP14
Gene Alias CLR11.2|GC-LRR|NALP14|NOD5|PAN8
Gene Description NLR family, pyrin domain containing 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EKAWSVSLKIFGKMNLKDLCERAKEEINWSAQTIGPDDAKAGETQEDQEAVLGDGTEYRNRIKEKFCITWDKKSLAGKPEDFHHGIAEKDRKLLEHLFDVDVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NLRP14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 338323
Iso type IgG

Enviar un mensaje


NLRP14 polyclonal antibody

NLRP14 polyclonal antibody