FAM123A polyclonal antibody
  • FAM123A polyclonal antibody

FAM123A polyclonal antibody

Ref: AB-PAB23544
FAM123A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM123A.
Información adicional
Size 100 uL
Gene Name FAM123A
Gene Alias FLJ25477
Gene Description family with sequence similarity 123A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VDDTYLQEFWDMLSQTEEQGPEPQEGAAKVAAALETKVVPETPKDTRCVEAAKDASSVKRRRLNRIPIEPHPKEEPKHPEKEQQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM123A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219287
Iso type IgG

Enviar un mensaje


FAM123A polyclonal antibody

FAM123A polyclonal antibody