FAM155A polyclonal antibody
  • FAM155A polyclonal antibody

FAM155A polyclonal antibody

Ref: AB-PAB23543
FAM155A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM155A.
Información adicional
Size 100 uL
Gene Name FAM155A
Gene Alias -
Gene Description family with sequence similarity 155, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM155A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 728215
Iso type IgG

Enviar un mensaje


FAM155A polyclonal antibody

FAM155A polyclonal antibody