RPGRIP1L polyclonal antibody
  • RPGRIP1L polyclonal antibody

RPGRIP1L polyclonal antibody

Ref: AB-PAB23540
RPGRIP1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPGRIP1L.
Información adicional
Size 100 uL
Gene Name RPGRIP1L
Gene Alias CORS3|DKFZp686C0668|JBTS7|KIAA1005|MKS5|NPHP8
Gene Description RPGRIP1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPGRIP1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23322
Iso type IgG

Enviar un mensaje


RPGRIP1L polyclonal antibody

RPGRIP1L polyclonal antibody