LCMT2 polyclonal antibody
  • LCMT2 polyclonal antibody

LCMT2 polyclonal antibody

Ref: AB-PAB23539
LCMT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LCMT2.
Información adicional
Size 100 uL
Gene Name LCMT2
Gene Alias KIAA0547|MGC9534|PPM2|TYW4
Gene Description leucine carboxyl methyltransferase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FKSEDNNTEDLKVTITKAGRKDDSTLCCWRHSTTEVSCQNQEYLFVYGGRSVVEPVLSDWHFLHVGTMAWVRIPVEGEVPEARHS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LCMT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9836
Iso type IgG

Enviar un mensaje


LCMT2 polyclonal antibody

LCMT2 polyclonal antibody