FAM214A polyclonal antibody
  • FAM214A polyclonal antibody

FAM214A polyclonal antibody

Ref: AB-PAB23536
FAM214A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM214A.
Información adicional
Size 100 uL
Gene Name FAM214A
Gene Alias KIAA1370
Gene Description family with sequence similarity 214, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TNEGKIRLKPETPRSETCISNDFYSHMPVGETNPLIGSLLQERQDVIARIAQHLEHIDPTASHIPRQSFNMHDSSSVASKVFRSSYEDKNLLKKNKDESSVSISHT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM214A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56204
Iso type IgG

Enviar un mensaje


FAM214A polyclonal antibody

FAM214A polyclonal antibody