RSPH3 polyclonal antibody
  • RSPH3 polyclonal antibody

RSPH3 polyclonal antibody

Ref: AB-PAB23511
RSPH3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RSPH3.
Información adicional
Size 100 uL
Gene Name RSPH3
Gene Alias RSHL2|RSP3|dJ111C20.1
Gene Description radial spoke 3 homolog (Chlamydomonas)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IIEVDMECQTDAFLDRPPTPLFIPAKTGKDVATQILEGELFDFDLEVKPVLEVLVGKTIEQSLLEVMEEEELANLRASQREYEELRN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RSPH3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83861
Iso type IgG

Enviar un mensaje


RSPH3 polyclonal antibody

RSPH3 polyclonal antibody