C12orf73 polyclonal antibody
  • C12orf73 polyclonal antibody

C12orf73 polyclonal antibody

Ref: AB-PAB23509
C12orf73 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf73.
Información adicional
Size 100 uL
Gene Name C12orf73
Gene Alias DKFZp547P055|FLJ13975
Gene Description chromosome 12 open reading frame 73
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf73.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 728568
Iso type IgG

Enviar un mensaje


C12orf73 polyclonal antibody

C12orf73 polyclonal antibody