SPINK9 polyclonal antibody
  • SPINK9 polyclonal antibody

SPINK9 polyclonal antibody

Ref: AB-PAB23501
SPINK9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPINK9.
Información adicional
Size 100 uL
Gene Name SPINK9
Gene Alias LEKTI2
Gene Description serine peptidase inhibitor, Kazal type 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPINK9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 643394
Iso type IgG

Enviar un mensaje


SPINK9 polyclonal antibody

SPINK9 polyclonal antibody