CCDC34 polyclonal antibody
  • CCDC34 polyclonal antibody

CCDC34 polyclonal antibody

Ref: AB-PAB23496
CCDC34 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC34.
Información adicional
Size 100 uL
Gene Name CCDC34
Gene Alias L15|NY-REN-41|RAMA3
Gene Description coiled-coil domain containing 34
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC34.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91057
Iso type IgG

Enviar un mensaje


CCDC34 polyclonal antibody

CCDC34 polyclonal antibody