DTD1 polyclonal antibody
  • DTD1 polyclonal antibody

DTD1 polyclonal antibody

Ref: AB-PAB23491
DTD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DTD1.
Información adicional
Size 100 uL
Gene Name DTD1
Gene Alias C20orf88|DUEB|HARS2|MGC119131|MGC41905|bA379J5.3|bA555E18.1|pqn-68
Gene Description D-tyrosyl-tRNA deacylase 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DTD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92675
Iso type IgG

Enviar un mensaje


DTD1 polyclonal antibody

DTD1 polyclonal antibody