C20orf196 polyclonal antibody
  • C20orf196 polyclonal antibody

C20orf196 polyclonal antibody

Ref: AB-PAB23490
C20orf196 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C20orf196.
Información adicional
Size 100 uL
Gene Name C20orf196
Gene Alias FLJ25067|RP4-784N16.1
Gene Description chromosome 20 open reading frame 196
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key ICC
Immunogen Prot. Seq NNSWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSASVCKCLSQKITQLRGQES
Form Liquid
Recomended Dilution Immunocytochemistry
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C20orf196.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149840
Iso type IgG

Enviar un mensaje


C20orf196 polyclonal antibody

C20orf196 polyclonal antibody