ANKRD12 polyclonal antibody
  • ANKRD12 polyclonal antibody

ANKRD12 polyclonal antibody

Ref: AB-PAB23488
ANKRD12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD12.
Información adicional
Size 100 uL
Gene Name ANKRD12
Gene Alias ANCO-2|ANCO1|FLJ20053|GAC-1|KIAA0874|Nbla00144
Gene Description ankyrin repeat domain 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MIDDRHILRKEQRKENEPEAEKTHLFAKQEKAFYPKSFKSKKQKPSRVLYSSTESSDEEALQNKKISTSCSVIPETSNSDMQTKKEYVVSGEHKQKGKVKRKLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23253
Iso type IgG

Enviar un mensaje


ANKRD12 polyclonal antibody

ANKRD12 polyclonal antibody