SNRPD1 polyclonal antibody
  • SNRPD1 polyclonal antibody

SNRPD1 polyclonal antibody

Ref: AB-PAB23487
SNRPD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNRPD1.
Información adicional
Size 100 uL
Gene Name SNRPD1
Gene Alias HsT2456|SMD1|SNRPD
Gene Description small nuclear ribonucleoprotein D1 polypeptide 16kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNRPD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6632
Iso type IgG

Enviar un mensaje


SNRPD1 polyclonal antibody

SNRPD1 polyclonal antibody