ITPKA polyclonal antibody
  • ITPKA polyclonal antibody

ITPKA polyclonal antibody

Ref: AB-PAB23484
ITPKA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ITPKA.
Información adicional
Size 100 uL
Gene Name ITPKA
Gene Alias IP3KA
Gene Description inositol 1,4,5-trisphosphate 3-kinase A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ITPKA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3706
Iso type IgG

Enviar un mensaje


ITPKA polyclonal antibody

ITPKA polyclonal antibody