SPAG9 polyclonal antibody
  • SPAG9 polyclonal antibody

SPAG9 polyclonal antibody

Ref: AB-PAB23483
SPAG9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPAG9.
Información adicional
Size 100 uL
Gene Name SPAG9
Gene Alias FLJ13450|FLJ14006|FLJ26141|FLJ34602|HLC4|JLP|KIAA0516|MGC117291|MGC14967|MGC74461|PHET|PIG6
Gene Description sperm associated antigen 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPAG9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9043
Iso type IgG

Enviar un mensaje


SPAG9 polyclonal antibody

SPAG9 polyclonal antibody