ANKRD49 polyclonal antibody
  • ANKRD49 polyclonal antibody

ANKRD49 polyclonal antibody

Ref: AB-PAB23479
ANKRD49 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD49.
Información adicional
Size 100 uL
Gene Name ANKRD49
Gene Alias FGIF|FLJ20189|FLJ20441|GBIF
Gene Description ankyrin repeat domain 49
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD49.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54851
Iso type IgG

Enviar un mensaje


ANKRD49 polyclonal antibody

ANKRD49 polyclonal antibody